Lineage for d6ejxd_ (6ejx D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435290Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
  6. 2435312Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (2 species)
  7. 3059167Species Mus musculus [TaxId:10090] [359229] (1 PDB entry)
  8. 3059168Domain d6ejxd_: 6ejx D: [359230]
    automated match to d1m10b_
    complexed with gol, imd, mes, peg, pol

Details for d6ejxd_

PDB Entry: 6ejx (more details), 2 Å

PDB Description: the metal ion-dependent adhesion site (midas) of the alphambeta2 integrin mac-1 i-domain promiscuously and competitively binds multiple ligands in the regulation of leukocyte function
PDB Compounds: (D:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d6ejxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ejxd_ c.10.2.7 (D:) von Willebrand factor binding domain of glycoprotein Ib alpha {Mus musculus [TaxId: 10090]}
sqhtcsiskvtsllevncenkkltalpadlpadtgilhlgenqlgtfstaslvhfthlty
lyldrceltslqtngkliklenldlshnnlkslpslgwalpalttldvsfnklgslspgv
ldglsqlqelylqnndlkslppglllpttklkklnlannklrelpsglldgledldtlyl
qrnwlrtipkgffgtlllpfvflhanswycdceilyfrhwlqenannvylwkqgvdvkdt
tpnvasvrcanldnapvysypgkgcp

SCOPe Domain Coordinates for d6ejxd_:

Click to download the PDB-style file with coordinates for d6ejxd_.
(The format of our PDB-style files is described here.)

Timeline for d6ejxd_:

  • d6ejxd_ appears in periodic updates to SCOPe 2.07 starting on 2018-10-25