Lineage for d1qflb2 (1qfl B:269-392)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 28409Protein Biosynthetic thiolase [53905] (1 species)
  7. 28410Species Zoogloea ramigera [TaxId:350] [53906] (3 PDB entries)
  8. 28414Domain d1qflb2: 1qfl B:269-392 [35911]

Details for d1qflb2

PDB Entry: 1qfl (more details), 1.92 Å

PDB Description: biosynthetic thiolase from zoogloea ramigera in complex with a reaction intermediate.

SCOP Domain Sequences for d1qflb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qflb2 c.95.1.1 (B:269-392) Biosynthetic thiolase {Zoogloea ramigera}
iqplgrivswatvgvdpkvmgtgpipasrkaleragwkigdldlveaneafaaqacavnk
dlgwdpsivnvnggaiaighpigasgarilntllfemkrrgarkglatlcigggmgvamc
iesl

SCOP Domain Coordinates for d1qflb2:

Click to download the PDB-style file with coordinates for d1qflb2.
(The format of our PDB-style files is described here.)

Timeline for d1qflb2: