PDB entry 1qfl

View 1qfl on RCSB PDB site
Description: biosynthetic thiolase from zoogloea ramigera in complex with a reaction intermediate.
Deposited on 1999-04-12, released 2000-04-19
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-19, with a file datestamp of 2000-04-19.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qflA (A:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qflB (B:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qflC (C:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qflD (D:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl