SCOPe 2.07: Domain d6cacd1: 6cac D:39-270

Lineage for d6cacd1 (6cac D:39-270)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)

8. Domain d6cacd1: 6cac D:39-270 [358846]
   Other proteins in same PDB: d6caca2, d6cacc2, d6cacd2
   automated match to d4eyba_
   complexed with ca, cd, co, ni, so4, zn

Details for d6cacd1

PDB Entry: 6cac, 1.79 Å

PDB Description: crystal structure of ndm-1 metallo-beta-lactamase harboring an insertion of a pro residue in l3 loop

PDB Compounds: (D:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6cacd1:

Sequence, based on SEQRES records:

>d6cacd1 d.157.1.0 (D:39-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
metgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtddq
taqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaa
qhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskaks
lgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

Sequence, based on observed residues (ATOM records):

>d6cacd1 d.157.1.0 (D:39-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
metgdqrfgdlvfrqlapnvwqhtsyldfgavapsnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

Timeline for d6cacd1:

• d6cacd1 is new in SCOPe 2.07-stable
  
• d6cacd1 appears in the current release, SCOPe 2.08