Lineage for d6cacd1 (6cac D:39-270)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (22 species)
    not a true protein
  7. 2556016Species Klebsiella pneumoniae [TaxId:573] [189718] (58 PDB entries)
  8. 3058784Domain d6cacd1: 6cac D:39-270 [358846]
    Other proteins in same PDB: d6caca2, d6cacc2, d6cacd2
    automated match to d4eyba_
    complexed with ca, cd, co, ni, so4, zn

Details for d6cacd1

PDB Entry: 6cac (more details), 1.79 Å

PDB Description: crystal structure of ndm-1 metallo-beta-lactamase harboring an insertion of a pro residue in l3 loop
PDB Compounds: (D:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d6cacd1:

Sequence, based on SEQRES records: (download)

>d6cacd1 d.157.1.0 (D:39-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
metgdqrfgdlvfrqlapnvwqhtsyldmpgfgavapsnglivrdggrvlvvdtawtddq
taqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaa
qhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskaks
lgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

Sequence, based on observed residues (ATOM records): (download)

>d6cacd1 d.157.1.0 (D:39-270) automated matches {Klebsiella pneumoniae [TaxId: 573]}
metgdqrfgdlvfrqlapnvwqhtsyldfgavapsnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl

SCOPe Domain Coordinates for d6cacd1:

Click to download the PDB-style file with coordinates for d6cacd1.
(The format of our PDB-style files is described here.)

Timeline for d6cacd1:

  • d6cacd1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-18