Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Paenibacillus macerans [TaxId:44252] [256324] (4 PDB entries) |
Domain d6aija3: 6aij A:498-584 [358424] Other proteins in same PDB: d6aija1, d6aija2, d6aija4 automated match to d4jcla3 complexed with ca; mutant |
PDB Entry: 6aij (more details), 2.1 Å
SCOPe Domain Sequences for d6aija3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aija3 b.1.18.0 (A:498-584) automated matches {Paenibacillus macerans [TaxId: 44252]} tspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkv aagktgvsvktssgtasntfksfnvlt
Timeline for d6aija3: