SCOPe 2.07: Domain d6aija3: 6aij A:498-584

Lineage for d6aija3 (6aij A:498-584)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Paenibacillus macerans [TaxId:44252] [256324] (4 PDB entries)

8. Domain d6aija3: 6aij A:498-584 [358424]
   Other proteins in same PDB: d6aija1, d6aija2, d6aija4
   automated match to d4jcla3
   complexed with ca; mutant

Details for d6aija3

PDB Entry: 6aij, 2.1 Å

PDB Description: cyclodextrin glycosyltransferase from paenibacillus macerans mutant n603d

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d6aija3:

Sequence; same for both SEQRES and ATOM records:

>d6aija3 b.1.18.0 (A:498-584) automated matches {Paenibacillus macerans [TaxId: 44252]}
tspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkv
aagktgvsvktssgtasntfksfnvlt

Timeline for d6aija3:

• d6aija3 is new in SCOPe 2.07-stable
  
• d6aija3 appears in the current release, SCOPe 2.08