Lineage for d6aija3 (6aij A:498-584)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (56 species)
    not a true protein
  7. 2363031Species Paenibacillus macerans [TaxId:44252] [256324] (3 PDB entries)
  8. 3058362Domain d6aija3: 6aij A:498-584 [358424]
    Other proteins in same PDB: d6aija1, d6aija2, d6aija4
    automated match to d4jcla3
    complexed with ca; mutant

Details for d6aija3

PDB Entry: 6aij (more details), 2.1 Å

PDB Description: cyclodextrin glycosyltransferase from paenibacillus macerans mutant n603d
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d6aija3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aija3 b.1.18.0 (A:498-584) automated matches {Paenibacillus macerans [TaxId: 44252]}
tspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkv
aagktgvsvktssgtasntfksfnvlt

SCOPe Domain Coordinates for d6aija3:

Click to download the PDB-style file with coordinates for d6aija3.
(The format of our PDB-style files is described here.)

Timeline for d6aija3:

  • d6aija3 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11