Lineage for d6mjnb1 (6mjn B:1-139)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613735Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 2613736Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 2613815Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 2613816Protein automated matches [190512] (7 species)
    not a true protein
  7. 2613846Species Legionella pneumophila [TaxId:446] [358323] (1 PDB entry)
  8. 2613848Domain d6mjnb1: 6mjn B:1-139 [358384]
    Other proteins in same PDB: d6mjnb2, d6mjnd2
    automated match to d1n2fa_
    complexed with cl

Details for d6mjnb1

PDB Entry: 6mjn (more details), 1.75 Å

PDB Description: crystal structure of an organic hydroperoxide resistance protein osmc, predicted redox protein, regulator of sulfide bond formation from legionella pneumophila
PDB Compounds: (B:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6mjnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjnb1 d.227.1.0 (B:1-139) automated matches {Legionella pneumophila [TaxId: 446]}
mkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfesa
irhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahevc
pysnairgnvdvklsvsvk

SCOPe Domain Coordinates for d6mjnb1:

Click to download the PDB-style file with coordinates for d6mjnb1.
(The format of our PDB-style files is described here.)

Timeline for d6mjnb1: