SCOPe 2.08: Domain d6mjnb1: 6mjn B:1-139

Lineage for d6mjnb1 (6mjn B:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.227: OsmC-like [82783] (1 superfamily)
   swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix

4. Superfamily d.227.1: OsmC-like [82784] (3 families)

5. Family d.227.1.0: automated matches [191395] (1 protein)
   not a true family

6. Protein automated matches [190512] (7 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:446] [358323] (1 PDB entry)

8. Domain d6mjnb1: 6mjn B:1-139 [358384]
   Other proteins in same PDB: d6mjnb2, d6mjnd2
   automated match to d1n2fa_
   complexed with cl

Details for d6mjnb1

PDB Entry: 6mjn, 1.75 Å

PDB Description: crystal structure of an organic hydroperoxide resistance protein osmc, predicted redox protein, regulator of sulfide bond formation from legionella pneumophila

PDB Compounds: (B:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6mjnb1:

Sequence; same for both SEQRES and ATOM records:

>d6mjnb1 d.227.1.0 (B:1-139) automated matches {Legionella pneumophila [TaxId: 446]}
mkalyttiakahggrnghvettdgllkldlamprelggeggatnpeqlfaagyaacfesa
irhvanvqkisledvsmtsevslyatpekgfklgvalhahitglnqneaealvakahevc
pysnairgnvdvklsvsvk

Timeline for d6mjnb1:

• d6mjnb1 first appeared in SCOPe 2.07