SCOP 1.73: Domain d1ftja_: 1ftj A:

Lineage for d1ftja_ (1ftj A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (53 PDB entries)

8. Domain d1ftja_: 1ftj A: [35826]

Details for d1ftja_

PDB Entry: 1ftj, 1.9 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with glutamate at 1.9 resolution

PDB Compounds: (A:) glutamate receptor subunit 2

SCOP Domain Sequences for d1ftja_:

Sequence; same for both SEQRES and ATOM records:

>d1ftja_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

Timeline for d1ftja_:

• d1ftja_ first appeared (with stable ids) in SCOP 1.55
  
• d1ftja_ appears in SCOP 1.71
  
• d1ftja_ appears in SCOP 1.75
  
• d1ftja_ appears in the current release, SCOPe 2.08