Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Cryptococcus neoformans [TaxId:235443] [321716] (3 PDB entries) |
Domain d6mfub_: 6mfu B: [358180] automated match to d1lvga_ complexed with 5gp, adp |
PDB Entry: 6mfu (more details), 1.6 Å
SCOPe Domain Sequences for d6mfub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mfub_ c.37.1.0 (B:) automated matches {Cryptococcus neoformans [TaxId: 235443]} rpinpdvvnrplvicgpsgtgkstllktlfesqpntfgfsvshttrkprpgeengreyhf vtkeefmegvgkgeflewaefggncygttfaaltalhprrcildielqgvlqlkakaplq tpplepvflflsppsisqlksrlsgrgtetdasirkrldaakeelryakegkydvyvvnd dlkvageklekvamgwegwktcgdtlpelnlaeld
Timeline for d6mfub_: