Lineage for d6mfub_ (6mfu B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (139 species)
    not a true protein
  7. 2452090Species Cryptococcus neoformans [TaxId:235443] [321716] (3 PDB entries)
  8. 3058118Domain d6mfub_: 6mfu B: [358180]
    automated match to d1lvga_
    complexed with 5gp, adp

Details for d6mfub_

PDB Entry: 6mfu (more details), 1.6 Å

PDB Description: crystal structure of a guanylate kinase from cryptococcus neoformans var. grubii serotype a in complex with gdp and adp
PDB Compounds: (B:) Guanylate kinase

SCOPe Domain Sequences for d6mfub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mfub_ c.37.1.0 (B:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
rpinpdvvnrplvicgpsgtgkstllktlfesqpntfgfsvshttrkprpgeengreyhf
vtkeefmegvgkgeflewaefggncygttfaaltalhprrcildielqgvlqlkakaplq
tpplepvflflsppsisqlksrlsgrgtetdasirkrldaakeelryakegkydvyvvnd
dlkvageklekvamgwegwktcgdtlpelnlaeld

SCOPe Domain Coordinates for d6mfub_:

Click to download the PDB-style file with coordinates for d6mfub_.
(The format of our PDB-style files is described here.)

Timeline for d6mfub_:

  • d6mfub_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-27