Lineage for d1hpbp_ (1hpb P:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879626Protein Histidine-binding protein [53872] (2 species)
  7. Species Salmonella typhimurium [TaxId:90371] [53874] (1 PDB entry)
  8. 1879631Domain d1hpbp_: 1hpb P: [35806]
    CA-atoms only
    complexed with his

Details for d1hpbp_

PDB Entry: 1hpb (more details), 2.5 Å

PDB Description: the bacterial periplasmic histidine-binding protein: structure(slash) function analysis of the ligand-binding site and comparison with related proteins
PDB Compounds: (P:) histidine-binding protein

SCOPe Domain Sequences for d1hpbp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpbp_ c.94.1.1 (P:) Histidine-binding protein {Salmonella typhimurium [TaxId: 90371]}
aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg

SCOPe Domain Coordinates for d1hpbp_:

Click to download the PDB-style file with coordinates for d1hpbp_.
(The format of our PDB-style files is described here.)

Timeline for d1hpbp_: