Lineage for d5ybca_ (5ybc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306061Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 2306107Protein automated matches [191121] (2 species)
    not a true protein
  7. 2306108Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)
  8. 3057839Domain d5ybca_: 5ybc A: [357901]
    automated match to d5e8ga_
    complexed with gol

Details for d5ybca_

PDB Entry: 5ybc (more details), 2.5 Å

PDB Description: x-ray structure of native ets-domain domain of ergp55
PDB Compounds: (A:) Transcriptional regulator ERG

SCOPe Domain Sequences for d5ybca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ybca_ a.4.5.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpnmnydklsral
ryyydknimtkvhgkryaykfdfhgiaqalqp

SCOPe Domain Coordinates for d5ybca_:

Click to download the PDB-style file with coordinates for d5ybca_.
(The format of our PDB-style files is described here.)

Timeline for d5ybca_:

  • d5ybca_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20