SCOPe 2.07: Domain d5ybcc_: 5ybc C:

Lineage for d5ybcc_ (5ybc C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (15 PDB entries)

8. Domain d5ybcc_: 5ybc C: [357888]
   automated match to d5e8ga_
   complexed with gol

Details for d5ybcc_

PDB Entry: 5ybc, 2.5 Å

PDB Description: x-ray structure of native ets-domain domain of ergp55

PDB Compounds: (C:) Transcriptional regulator ERG

SCOPe Domain Sequences for d5ybcc_:

Sequence; same for both SEQRES and ATOM records:

>d5ybcc_ a.4.5.21 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpnmnydklsral
ryyydknimtkvhgkryaykfdfhgiaqalq

Timeline for d5ybcc_:

• d5ybcc_ is new in SCOPe 2.07-stable
  
• d5ybcc_ appears in the current release, SCOPe 2.08