PDB entry 5ybc

View 5ybc on RCSB PDB site
Description: X-ray structure of native ETS-domain domain of Ergp55
Class: structural protein
Keywords: ETS transcription factor, Ergp55, STRUCTURAL PROTEIN
Deposited on 2017-09-04, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator ERG
    Species: Homo sapiens [TaxId:9606]
    Gene: ERG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ybca_
  • Chain 'C':
    Compound: Transcriptional regulator ERG
    Species: Homo sapiens [TaxId:9606]
    Gene: ERG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ybcc_
  • Heterogens: GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ybcA (A:)
qiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpnmnydklsral
ryyydknimtkvhgkryaykfdfhgiaqalqp

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >5ybcC (C:)
qiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpnmnydklsral
ryyydknimtkvhgkryaykfdfhgiaqalqp

    Sequence, based on observed residues (ATOM records): (download) 
    >5ybcC (C:)
qiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpnmnydklsral
ryyydknimtkvhgkryaykfdfhgiaqalq