Lineage for d6g8mh_ (6g8m H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600598Domain d6g8mh_: 6g8m H: [357503]
    Other proteins in same PDB: d6g8me_, d6g8mg_, d6g8mi_, d6g8mj_, d6g8mk_, d6g8ml_, d6g8mn_, d6g8mo_, d6g8ms_, d6g8mu_, d6g8mw_, d6g8mx_, d6g8my_, d6g8mz_
    automated match to d5fg9h_
    complexed with cl, eqe, mg

Details for d6g8mh_

PDB Entry: 6g8m (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with cystargolide b derivative 1
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6g8mh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g8mh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d6g8mh_:

Click to download the PDB-style file with coordinates for d6g8mh_.
(The format of our PDB-style files is described here.)

Timeline for d6g8mh_: