Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6g8mh_: 6g8m H: [357503] Other proteins in same PDB: d6g8me_, d6g8mg_, d6g8mi_, d6g8mj_, d6g8mk_, d6g8ml_, d6g8mn_, d6g8mo_, d6g8ms_, d6g8mu_, d6g8mw_, d6g8mx_, d6g8my_, d6g8mz_ automated match to d5fg9h_ complexed with cl, eqe, mg |
PDB Entry: 6g8m (more details), 2.7 Å
SCOPe Domain Sequences for d6g8mh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g8mh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d6g8mh_: