Lineage for d6aw8b_ (6aw8 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2500489Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2500665Protein automated matches [190251] (6 species)
    not a true protein
  7. 2500674Species Nannospalax galili [TaxId:1026970] [357296] (6 PDB entries)
  8. 2500681Domain d6aw8b_: 6aw8 B: [357411]
    automated match to d4p7ka_
    complexed with ca, sah

Details for d6aw8b_

PDB Entry: 6aw8 (more details), 2.25 Å

PDB Description: 2.25a resolution domain swapped dimer structure of sah bound catechol o-methyltransferase (comt) from nannospalax galili
PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d6aw8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aw8b_ c.66.1.1 (B:) automated matches {Nannospalax galili [TaxId: 1026970]}
dtkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslv
lelgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdl
ipqlkkydvdtldlvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayv
rgsssfecthyssyleymkvvdglekavykgp

SCOPe Domain Coordinates for d6aw8b_:

Click to download the PDB-style file with coordinates for d6aw8b_.
(The format of our PDB-style files is described here.)

Timeline for d6aw8b_: