SCOPe 2.07: Domain d6cwtf_: 6cwt F:

Lineage for d6cwtf_ (6cwt F:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
   5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle

4. Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families)
   automatically mapped to Pfam PF00906

5. Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)

6. Protein automated matches [191131] (3 species)
   not a true protein

7. Species Hepatitis B virus genotype d subtype adw [TaxId:10419] [189224] (4 PDB entries)

8. Domain d6cwtf_: 6cwt F: [356808]
   Other proteins in same PDB: d6cwtb1, d6cwtb2, d6cwtd1, d6cwtd2
   automated match to d4bmga_

Details for d6cwtf_

PDB Entry: 6cwt, 3.15 Å

PDB Description: hepatitis b core-antigen in complex with fab e21

PDB Compounds: (F:) capsid protein

SCOPe Domain Sequences for d6cwtf_:

Sequence, based on SEQRES records:

>d6cwtf_ a.62.1.1 (F:) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
idpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehasphhtalrqailcw
gdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhisaltfgretvleylvsf
gvwirtppayrppnapi

Sequence, based on observed residues (ATOM records):

>d6cwtf_ a.62.1.1 (F:) automated matches {Hepatitis B virus genotype d subtype adw [TaxId: 10419]}
idpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehasphhtalrqailcw
gdlmtlatwvgntnvglkfrqllwfhisaltfgretvleylvsfgvwirtppayrppnap
i

Timeline for d6cwtf_:

• d6cwtf_ is new in SCOPe 2.07-stable
  
• d6cwtf_ appears in the current release, SCOPe 2.08