Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein Purine repressor (PurR), C-terminal domain [53835] (1 species) |
Species Escherichia coli [TaxId:562] [53836] (24 PDB entries) |
Domain d2puda2: 2pud A:59-340 [35678] Other proteins in same PDB: d2puda1 protein/DNA complex; complexed with hpa |
PDB Entry: 2pud (more details), 2.6 Å
SCOPe Domain Sequences for d2puda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2puda2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh reigvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr
Timeline for d2puda2: