SCOPe 2.07: Domain d5nbld2: 5nbl D:147-374

Lineage for d5nbld2 (5nbl D:147-374)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Saccharomyces cerevisiae [TaxId:559292] [356542] (1 PDB entry)

8. Domain d5nbld2: 5nbl D:147-374 [356601]
   Other proteins in same PDB: d5nble_, d5nblf_
   automated match to d1yaga2
   complexed with atp, ca

Details for d5nbld2

PDB Entry: 5nbl, 2.8 Å

PDB Description: crystal structure of the arp4-n-actin(apo-state) heterodimer bound by a nanobody

PDB Compounds: (D:) actin

SCOPe Domain Sequences for d5nbld2:

Sequence; same for both SEQRES and ATOM records:

>d5nbld2 c.55.1.1 (D:147-374) Actin {Saccharomyces cerevisiae [TaxId: 559292]}
rttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilsergysfsttaer
eivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhpsv
lglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmk
vkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkc

Timeline for d5nbld2:

• d5nbld2 is new in SCOPe 2.07-stable
  
• d5nbld2 appears in the current release, SCOPe 2.08