SCOPe 2.07: Domain d5nble_: 5nbl E:

Lineage for d5nble_ (5nbl E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)

8. Domain d5nble_: 5nbl E: [356495]
   Other proteins in same PDB: d5nblc1, d5nblc2, d5nbld1, d5nbld2
   automated match to d1mqkh_
   complexed with atp, ca

Details for d5nble_

PDB Entry: 5nbl, 2.8 Å

PDB Description: crystal structure of the arp4-n-actin(apo-state) heterodimer bound by a nanobody

PDB Compounds: (E:) nAct-Nanobody

SCOPe Domain Sequences for d5nble_:

Sequence; same for both SEQRES and ATOM records:

>d5nble_ b.1.1.1 (E:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvesgggsvqagdslrlsctasgrtftnygmgwfrqapgkerefvaaigrfgfplyy
sdsvkgrftisrdnakttvylqmhnlkpedtaiyfcaarnprataedvsaydywgqgtqv
tv

Timeline for d5nble_:

• d5nble_ is new in SCOPe 2.07-stable
  
• d5nble_ appears in the current release, SCOPe 2.08