Lineage for d5zzwa_ (5zzw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895014Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [356562] (3 PDB entries)
  8. 2895015Domain d5zzwa_: 5zzw A: [356588]
    automated match to d1zkda1
    complexed with sah

Details for d5zzwa_

PDB Entry: 5zzw (more details), 2.6 Å

PDB Description: proteobacterial origin of protein arginine methylation and regulation of complex i assembly by mida
PDB Compounds: (A:) Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial

SCOPe Domain Sequences for d5zzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zzwa_ c.66.1.0 (A:) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
kypitdfekylqditkvrgpmsidtfikevltnpkygyymnkdvfgkggdfitapevsql
fgemigiwcvatweamgkpkklqivemgpgrgtlmkdilrstkvfkefydsisvhlveas
pankktqkqnllyfkdkainfdhktigetpngikvtwvgkleevptdiptlflaqeffda
lpihvfrfsrekndwcevlvdeditehgeyylrfvqskgptlmttavkhllpefgldgyq
velglaglaisqqianridksggaaliidygydkivksslqairdhefvdildkpgtadl
svwvdfqtirktvkllknkstaigpvdqgiflkemgiehrlaqigrkldsnekfeelvmg
ykklvdpkemgtnykviticdknitpigfstsktyddedl

SCOPe Domain Coordinates for d5zzwa_:

Click to download the PDB-style file with coordinates for d5zzwa_.
(The format of our PDB-style files is described here.)

Timeline for d5zzwa_: