Class b: All beta proteins [48724] (178 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries) |
Domain d6gmql_: 6gmq L: [356459] Other proteins in same PDB: d6gmqa_, d6gmqb1, d6gmqb2, d6gmqd_, d6gmqe1, d6gmqe2, d6gmqg_, d6gmqh_, d6gmqj_, d6gmqk1, d6gmqk2 automated match to d1lqbc_ complexed with act, f4k, ipa |
PDB Entry: 6gmq (more details), 2.76 Å
SCOPe Domain Sequences for d6gmql_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gmql_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqer
Timeline for d6gmql_: