Lineage for d1lqbc_ (1lqb C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2378586Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2378587Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2378588Protein VHL [49470] (1 species)
  7. 2378589Species Human (Homo sapiens) [TaxId:9606] [49471] (39 PDB entries)
  8. 2378591Domain d1lqbc_: 1lqb C: [74186]
    Other proteins in same PDB: d1lqba_, d1lqbb_
    complexed with Hif-1alpha oxyproline peptide (chain D)
    complexed with so4

Details for d1lqbc_

PDB Entry: 1lqb (more details), 2 Å

PDB Description: Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the pVHL/elongin-C/elongin-B complex
PDB Compounds: (C:) von hippel-lindau disease tumor supressor

SCOPe Domain Sequences for d1lqbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqbc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
vrslyedledhpnvqkdlerltqeriahqr

SCOPe Domain Coordinates for d1lqbc_:

Click to download the PDB-style file with coordinates for d1lqbc_.
(The format of our PDB-style files is described here.)

Timeline for d1lqbc_: