Class b: All beta proteins [48724] (177 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (27 PDB entries) |
Domain d1lqbc_: 1lqb C: [74186] Other proteins in same PDB: d1lqba_, d1lqbb_ complexed with Hif-1alpha oxyproline peptide (chain D) complexed with so4 |
PDB Entry: 1lqb (more details), 2 Å
SCOPe Domain Sequences for d1lqbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqbc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]} pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi vrslyedledhpnvqkdlerltqeriahqr
Timeline for d1lqbc_: