Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (18 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries) |
Domain d6btnb_: 6btn B: [355849] automated match to d3edha_ complexed with e8m, edo, zn |
PDB Entry: 6btn (more details), 2.05 Å
SCOPe Domain Sequences for d6btnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6btnb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig qrtrlskgdiaqarklykcpa
Timeline for d6btnb_: