Lineage for d6btnb_ (6btn B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 3055787Domain d6btnb_: 6btn B: [355849]
    automated match to d3edha_
    complexed with e8m, edo, zn

Details for d6btnb_

PDB Entry: 6btn (more details), 2.05 Å

PDB Description: bmp1 complexed with a reverse hydroxymate - compound 1
PDB Compounds: (B:) Bone morphogenetic protein 1

SCOPe Domain Sequences for d6btnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6btnb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcpa

SCOPe Domain Coordinates for d6btnb_:

Click to download the PDB-style file with coordinates for d6btnb_.
(The format of our PDB-style files is described here.)

Timeline for d6btnb_:

  • d6btnb_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-09