SCOPe 2.07: Domain d6dhmd2: 6dhm D:209-495

Lineage for d6dhmd2 (6dhm D:209-495)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225674] (6 PDB entries)

8. Domain d6dhmd2: 6dhm D:209-495 [355337]
   Other proteins in same PDB: d6dhma1, d6dhmb1, d6dhmc1, d6dhmd1, d6dhme1, d6dhmf1
   automated match to d3etda2
   complexed with glu, gtp, ndp, zn

Details for d6dhmd2

PDB Entry: 6dhm, 3 Å

PDB Description: bovine glutamate dehydrogenase complexed with zinc

PDB Compounds: (D:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d6dhmd2:

Sequence; same for both SEQRES and ATOM records:

>d6dhmd2 c.2.1.7 (D:209-495) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyne

Timeline for d6dhmd2:

• d6dhmd2 is new in SCOPe 2.07-stable
  
• d6dhmd2 appears in the current release, SCOPe 2.08