Lineage for d6dhmf1 (6dhm F:1-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498096Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2498097Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2498456Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2498457Protein automated matches [226864] (38 species)
    not a true protein
  7. 2498512Species Bos taurus [TaxId:9913] [355109] (1 PDB entry)
  8. 2498518Domain d6dhmf1: 6dhm F:1-208 [355228]
    Other proteins in same PDB: d6dhma2, d6dhmb2, d6dhmc2, d6dhmd2, d6dhme2, d6dhmf2
    automated match to d3etda1
    complexed with glu, gtp, ndp, zn

Details for d6dhmf1

PDB Entry: 6dhm (more details), 3 Å

PDB Description: bovine glutamate dehydrogenase complexed with zinc
PDB Compounds: (F:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d6dhmf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dhmf1 c.58.1.0 (F:1-208) automated matches {Bos taurus [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d6dhmf1:

Click to download the PDB-style file with coordinates for d6dhmf1.
(The format of our PDB-style files is described here.)

Timeline for d6dhmf1: