Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (38 species) not a true protein |
Species Bos taurus [TaxId:9913] [355109] (1 PDB entry) |
Domain d6dhmf1: 6dhm F:1-208 [355228] Other proteins in same PDB: d6dhma2, d6dhmb2, d6dhmc2, d6dhmd2, d6dhme2, d6dhmf2 automated match to d3etda1 complexed with glu, gtp, ndp, zn |
PDB Entry: 6dhm (more details), 3 Å
SCOPe Domain Sequences for d6dhmf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dhmf1 c.58.1.0 (F:1-208) automated matches {Bos taurus [TaxId: 9913]} adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrgilriikpcnhvls lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia dtyastighydinahacvtgkpisqggi
Timeline for d6dhmf1: