Lineage for d5qiga_ (5qig A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828590Species Human (Homo sapiens) [TaxId:9606] [189110] (18 PDB entries)
  8. 2828599Domain d5qiga_: 5qig A: [355014]
    automated match to d2rdua_
    complexed with fmn, gwp

Details for d5qiga_

PDB Entry: 5qig (more details), 1.42 Å

PDB Description: pandda analysis group deposition of models with modelled events (e.g. bound ligands) -- crystal structure of hao1 in complex with z1407672867
PDB Compounds: (A:) hydroxyacid oxidase 1

SCOPe Domain Sequences for d5qiga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qiga_ c.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdls
tsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagp
ealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrm
knfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilrgdd
areavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlka
lalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvrk

SCOPe Domain Coordinates for d5qiga_:

Click to download the PDB-style file with coordinates for d5qiga_.
(The format of our PDB-style files is described here.)

Timeline for d5qiga_: