Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [354410] (2 PDB entries) |
Domain d6duxa2: 6dux A:168-440 [354411] Other proteins in same PDB: d6duxa1, d6duxa3, d6duxb1, d6duxb3 automated match to d1u8xx2 complexed with act, bct, cl, gol, lmr, nad |
PDB Entry: 6dux (more details), 2.25 Å
SCOPe Domain Sequences for d6duxa2:
Sequence, based on SEQRES records: (download)
>d6duxa2 d.162.1.0 (A:168-440) automated matches {Klebsiella pneumoniae [TaxId: 573]} icdmpigiegrmaqivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakyg yvppsndphteaswndtfakakdvqaldpqtmpntylkyylfpdyvvahsnpertranev mdhreknvfsacraiiaagkstagdleidehasyivdlataiafntqermllivpnngai hnfdadamveipclvghngpepltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwq aitlsktvpsasvakailddliaankdywpelh
>d6duxa2 d.162.1.0 (A:168-440) automated matches {Klebsiella pneumoniae [TaxId: 573]} icdmpigiegrmaqivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakyg yvppsaswndtfakakdvqaldpqtmpntylkyylfpdyvvahsnpertranevmdhrek nvfsacraiiaagkstagdleidehasyivdlataiafntqermllivpnngaihnfdad amveipclvghngpepltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwqaitlsk tvpsasvakailddliaankdywpelh
Timeline for d6duxa2: