Lineage for d6duxa2 (6dux A:168-440)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 3054348Species Klebsiella pneumoniae [TaxId:573] [354410] (2 PDB entries)
  8. 3054349Domain d6duxa2: 6dux A:168-440 [354411]
    Other proteins in same PDB: d6duxa1, d6duxa3, d6duxb1, d6duxb3
    automated match to d1u8xx2
    complexed with act, bct, cl, gol, lmr, nad

Details for d6duxa2

PDB Entry: 6dux (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with nad.
PDB Compounds: (A:) 6-phospho-alpha-glucosidase

SCOPe Domain Sequences for d6duxa2:

Sequence, based on SEQRES records: (download)

>d6duxa2 d.162.1.0 (A:168-440) automated matches {Klebsiella pneumoniae [TaxId: 573]}
icdmpigiegrmaqivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakyg
yvppsndphteaswndtfakakdvqaldpqtmpntylkyylfpdyvvahsnpertranev
mdhreknvfsacraiiaagkstagdleidehasyivdlataiafntqermllivpnngai
hnfdadamveipclvghngpepltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwq
aitlsktvpsasvakailddliaankdywpelh

Sequence, based on observed residues (ATOM records): (download)

>d6duxa2 d.162.1.0 (A:168-440) automated matches {Klebsiella pneumoniae [TaxId: 573]}
icdmpigiegrmaqivglkdrkqmrvryyglnhfgwwtsiedldgndlmpklreyvakyg
yvppsaswndtfakakdvqaldpqtmpntylkyylfpdyvvahsnpertranevmdhrek
nvfsacraiiaagkstagdleidehasyivdlataiafntqermllivpnngaihnfdad
amveipclvghngpepltvgdiphfqkglmsqqvaveklvvdaweqrsyhklwqaitlsk
tvpsasvakailddliaankdywpelh

SCOPe Domain Coordinates for d6duxa2:

Click to download the PDB-style file with coordinates for d6duxa2.
(The format of our PDB-style files is described here.)

Timeline for d6duxa2:

  • d6duxa2 appears in periodic updates to SCOPe 2.07 starting on 2018-07-05