SCOPe 2.07: Domain d5yptd2: 5ypt D:238-393

Lineage for d5yptd2 (5ypt D:238-393)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.0: automated matches [196908] (1 protein)
not a true family
Protein automated matches [196909] (81 species)
not a true protein
Species Marchantia polymorpha [TaxId:3197] [354367] (1 PDB entry)
Domain d5yptd2: 5ypt D:238-393 [354370]
automated match to d3wd8a2

Details for d5yptd2

PDB Entry: 5ypt (more details), 2.39 Å

PDB Description: crystal structure of marchantia paleacea chalone synthase like 1 (chsl1)

PDB Compounds: (D:) Stilbenecarboxylate synthase 1

SCOPe Domain Sequences for d5yptd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yptd2 c.95.1.0 (D:238-393) automated matches {Marchantia polymorpha [TaxId: 3197]}
qfeihwsgetilpesdgaiegrlteaglifhllkdvpglisrntlpifnkaievagspsw
ndlfwcvhpggraildevaktlslkpekleatrdilynygnmsgasvlfvldqmrrrsae
kksrttgegcewglvvgfgpgltvevsvlraiatgh

SCOPe Domain Coordinates for d5yptd2:

Click to download the PDB-style file with coordinates for d5yptd2.
(The format of our PDB-style files is described here.)

Timeline for d5yptd2: