Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Marchantia polymorpha [TaxId:3197] [354367] (1 PDB entry) |
Domain d5yptd1: 5ypt D:10-237 [354369] automated match to d3wd8a1 |
PDB Entry: 5ypt (more details), 2.39 Å
SCOPe Domain Sequences for d5yptd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yptd1 c.95.1.0 (D:10-237) automated matches {Marchantia polymorpha [TaxId: 3197]} ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekp
Timeline for d5yptd1: