Lineage for d5yptd1 (5ypt D:10-237)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525031Species Marchantia polymorpha [TaxId:3197] [354367] (1 PDB entry)
  8. 2525038Domain d5yptd1: 5ypt D:10-237 [354369]
    automated match to d3wd8a1

Details for d5yptd1

PDB Entry: 5ypt (more details), 2.39 Å

PDB Description: crystal structure of marchantia paleacea chalone synthase like 1 (chsl1)
PDB Compounds: (D:) Stilbenecarboxylate synthase 1

SCOPe Domain Sequences for d5yptd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yptd1 c.95.1.0 (D:10-237) automated matches {Marchantia polymorpha [TaxId: 3197]}
ykhrraagpatvlaigkatpptaysqseypdfffditntshktelkakfaricknsgint
ryfhctedilkanpsmctylepsldvrqdiairevprlaekaaiealaewgqprdqithv
vfattsgvnmpgadltltrllglnpnvkrtmlyqqgcfggatvlrvakdlaennkgarvl
tvvseltcvtfrapneehldnlvgsaifgdgasvlvigsdpipevekp

SCOPe Domain Coordinates for d5yptd1:

Click to download the PDB-style file with coordinates for d5yptd1.
(The format of our PDB-style files is described here.)

Timeline for d5yptd1: