Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Zika virus (strain mr 766) [TaxId:64320] [319757] (10 PDB entries) |
Domain d5y6ma2: 5y6m A:482-617 [354340] Other proteins in same PDB: d5y6ma1 automated match to d5txga2 complexed with adp, af3, mn |
PDB Entry: 5y6m (more details), 2 Å
SCOPe Domain Sequences for d5y6ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y6ma2 c.37.1.0 (A:482-617) automated matches {Zika virus (strain mr 766) [TaxId: 64320]} edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs dhaalksfkefaagkr
Timeline for d5y6ma2: