Lineage for d5y6ma2 (5y6m A:482-617)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873162Species Zika virus (strain mr 766) [TaxId:64320] [319757] (10 PDB entries)
  8. 2873169Domain d5y6ma2: 5y6m A:482-617 [354340]
    Other proteins in same PDB: d5y6ma1
    automated match to d5txga2
    complexed with adp, af3, mn

Details for d5y6ma2

PDB Entry: 5y6m (more details), 2 Å

PDB Description: zika virus helicase in complex with adp-alf3
PDB Compounds: (A:) Helicase domain from Genome polyprotein

SCOPe Domain Sequences for d5y6ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y6ma2 c.37.1.0 (A:482-617) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs
dhaalksfkefaagkr

SCOPe Domain Coordinates for d5y6ma2:

Click to download the PDB-style file with coordinates for d5y6ma2.
(The format of our PDB-style files is described here.)

Timeline for d5y6ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y6ma1