SCOPe 2.07: Domain d5xu7c_: 5xu7 C:

Lineage for d5xu7c_ (5xu7 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [341034] (3 PDB entries)

8. Domain d5xu7c_: 5xu7 C: [354183]
   automated match to d5vbxa_
   complexed with cl, gol

Details for d5xu7c_

PDB Entry: 5xu7, 1.84 Å

PDB Description: crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps)

PDB Compounds: (C:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d5xu7c_:

Sequence, based on SEQRES records:

>d5xu7c_ d.150.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat
viies

Sequence, based on observed residues (ATOM records):

>d5xu7c_ d.150.1.0 (C:) automated matches {Escherichia coli [TaxId: 83333]}
ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
kafglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacatviies

Timeline for d5xu7c_:

• d5xu7c_ is new in SCOPe 2.07-stable
  
• d5xu7c_ appears in the current release, SCOPe 2.08