Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (11 species) not a true protein |
Species Escherichia coli [TaxId:83333] [341034] (3 PDB entries) |
Domain d5xu7b_: 5xu7 B: [354163] automated match to d5vbxa_ complexed with cl, gol |
PDB Entry: 5xu7 (more details), 1.84 Å
SCOPe Domain Sequences for d5xu7b_:
Sequence, based on SEQRES records: (download)
>d5xu7b_ d.150.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat viies
>d5xu7b_ d.150.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]} ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa kafglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacatviies
Timeline for d5xu7b_: