Lineage for d5xu7b_ (5xu7 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594189Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2594190Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2594223Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 2594224Protein automated matches [191061] (11 species)
    not a true protein
  7. 2594252Species Escherichia coli [TaxId:83333] [341034] (3 PDB entries)
  8. 2594254Domain d5xu7b_: 5xu7 B: [354163]
    automated match to d5vbxa_
    complexed with cl, gol

Details for d5xu7b_

PDB Entry: 5xu7 (more details), 1.84 Å

PDB Description: crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps)
PDB Compounds: (B:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d5xu7b_:

Sequence, based on SEQRES records: (download)

>d5xu7b_ d.150.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
kafgtgirnglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacat
viies

Sequence, based on observed residues (ATOM records): (download)

>d5xu7b_ d.150.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ailglgtdiveiarieaviarsgdrlarrvlsdnewaiwkthhqpvrflakrfavkeaaa
kafglafnqfevfndelgkprlrlwgealklaeklgvanmhvtladerhyacatviies

SCOPe Domain Coordinates for d5xu7b_:

Click to download the PDB-style file with coordinates for d5xu7b_.
(The format of our PDB-style files is described here.)

Timeline for d5xu7b_: