Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins) |
Domain d3pmga3: 3pmg A:304-420 [35410] Other proteins in same PDB: d3pmga1, d3pmga4, d3pmgb1, d3pmgb4 complexed with mg |
PDB Entry: 3pmg (more details), 2.4 Å
SCOPe Domain Sequences for d3pmga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmga3 c.84.1.1 (A:304-420) Phosphoglucomutase, middle and C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
Timeline for d3pmga3:
View in 3D Domains from other chains: (mouse over for more information) d3pmgb1, d3pmgb2, d3pmgb3, d3pmgb4 |