Lineage for d5ty7b1 (5ty7 B:25-315)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619196Protein automated matches [190161] (30 species)
    not a true protein
  7. 2619597Species Staphylococcus aureus [TaxId:93062] [352201] (11 PDB entries)
  8. 2619615Domain d5ty7b1: 5ty7 B:25-315 [353615]
    Other proteins in same PDB: d5ty7a2, d5ty7b2
    automated match to d3huna1
    complexed with na, nff, zn

Details for d5ty7b1

PDB Entry: 5ty7 (more details), 1.89 Å

PDB Description: crystal structure of wild-type s. aureus penicillin binding protein 4 (pbp4) in complex with nafcillin
PDB Compounds: (B:) Penicillin-binding protein 4

SCOPe Domain Sequences for d5ty7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ty7b1 e.3.1.1 (B:25-315) automated matches {Staphylococcus aureus [TaxId: 93062]}
tnsdvtpvqaanqygyaglsaayeptsavnvsqtgqllyqynidtkwnpasmtklmtmyl
tleavnkgqlslddtvtmtnkeyimstlpelsntklypgqvwtiadllqitvsnssnaaa
lilakkvskntsdfvdlmnnkakaigmknthfvnptgaensrlrtfaptkykdqertvtt
ardyaildlhviketpkildftkqlaptthavtyytfnfslegakmslpgtdglktgssd
tanynhtittkrgkfrinqvimgagdyknlggekqrnmmgnalmersfdqy

SCOPe Domain Coordinates for d5ty7b1:

Click to download the PDB-style file with coordinates for d5ty7b1.
(The format of our PDB-style files is described here.)

Timeline for d5ty7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ty7b2