Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries) |
Domain d5xr6b1: 5xr6 B:10-179 [353609] Other proteins in same PDB: d5xr6a2, d5xr6b2 automated match to d1doaa_ complexed with gnp, mg |
PDB Entry: 5xr6 (more details), 2.6 Å
SCOPe Domain Sequences for d5xr6b1:
Sequence, based on SEQRES records: (download)
>d5xr6b1 c.37.1.0 (B:10-179) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ydylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiwdt agqeryraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcd lrhlvavkteeakafaereslyfmetsaldatnvenaftevltqihkivs
>d5xr6b1 c.37.1.0 (B:10-179) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ydylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiwdt agqeraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcdlr hlvavkteeakafaereslyfmetsaldatnvenaftevltqihkivs
Timeline for d5xr6b1: