SCOPe 2.08: Domain d5xr6b1: 5xr6 B:10-179

Lineage for d5xr6b1 (5xr6 B:10-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (8 PDB entries)

8. Domain d5xr6b1: 5xr6 B:10-179 [353609]
   Other proteins in same PDB: d5xr6a2, d5xr6b2
   automated match to d1doaa_
   complexed with gnp, mg

Details for d5xr6b1

PDB Entry: 5xr6, 2.6 Å

PDB Description: crystal structure of raba1a in complex with gppnhp

PDB Compounds: (B:) Ras-related protein RABA1a

SCOPe Domain Sequences for d5xr6b1:

Sequence, based on SEQRES records:

>d5xr6b1 c.37.1.0 (B:10-179) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ydylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiwdt
agqeryraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcd
lrhlvavkteeakafaereslyfmetsaldatnvenaftevltqihkivs

Sequence, based on observed residues (ATOM records):

>d5xr6b1 c.37.1.0 (B:10-179) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ydylfklvligdsgvgksnllsrftknefnleskstigvefatkttkvegkvvkaqiwdt
agqeraitsayyrgavgalliydvtrhatfenaarwlrelrghtdpnivvmlignkcdlr
hlvavkteeakafaereslyfmetsaldatnvenaftevltqihkivs

Timeline for d5xr6b1:

• d5xr6b1 first appeared in SCOPe 2.07