SCOPe 2.07: Domain d5wvxa_: 5wvx A:

Lineage for d5wvxa_ (5wvx A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.0: automated matches [191368] (1 protein)
   not a true family

6. Protein automated matches [190445] (10 species)
   not a true protein

7. Species Alocasia macrorrhizos [TaxId:4456] [353546] (2 PDB entries)

8. Domain d5wvxa_: 5wvx A: [353547]
   automated match to d5dvha_
   complexed with cit, nga

Details for d5wvxa_

PDB Entry: 5wvx, 3 Å

PDB Description: crystal structure of bifunctional kunitz type trypsin /amylase inhibitor (amtin) from the tubers of alocasia macrorrhiza

PDB Compounds: (A:) Trypsin/chymotrypsin inhibitor

SCOPe Domain Sequences for d5wvxa_:

Sequence, based on SEQRES records:

>d5wvxa_ b.42.4.0 (A:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesph

Sequence, based on observed residues (ATOM records):

>d5wvxa_ b.42.4.0 (A:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrggltlaapkgcplnvaqapfdeysgrplaffpena
dddtvqegstlyimfpeptrcpqstvwtfdrtggttskaigphnsrfairkagdasyqie
vcpcstgverpscrmgtlglaeggknvllninnesph

Timeline for d5wvxa_:

• d5wvxa_ is new in SCOPe 2.07-stable
  
• d5wvxa_ appears in the current release, SCOPe 2.08