Lineage for d5wvxa_ (5wvx A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385751Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2385752Protein automated matches [190445] (8 species)
    not a true protein
  7. 3053484Species Alocasia macrorrhizos [TaxId:4456] [353546] (2 PDB entries)
  8. 3053485Domain d5wvxa_: 5wvx A: [353547]
    automated match to d5dvha_
    complexed with cit, nga

Details for d5wvxa_

PDB Entry: 5wvx (more details), 3 Å

PDB Description: crystal structure of bifunctional kunitz type trypsin /amylase inhibitor (amtin) from the tubers of alocasia macrorrhiza
PDB Compounds: (A:) Trypsin/chymotrypsin inhibitor

SCOPe Domain Sequences for d5wvxa_:

Sequence, based on SEQRES records: (download)

>d5wvxa_ b.42.4.0 (A:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesph

Sequence, based on observed residues (ATOM records): (download)

>d5wvxa_ b.42.4.0 (A:) automated matches {Alocasia macrorrhizos [TaxId: 4456]}
tnpvldvdgnelqrgqlyyatsvmrggltlaapkgcplnvaqapfdeysgrplaffpena
dddtvqegstlyimfpeptrcpqstvwtfdrtggttskaigphnsrfairkagdasyqie
vcpcstgverpscrmgtlglaeggknvllninnesph

SCOPe Domain Coordinates for d5wvxa_:

Click to download the PDB-style file with coordinates for d5wvxa_.
(The format of our PDB-style files is described here.)

Timeline for d5wvxa_:

  • d5wvxa_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-14