Lineage for d5nyxp1 (5nyx P:1-105)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366493Domain d5nyxp1: 5nyx P:1-105 [353111]
    Other proteins in same PDB: d5nyxl2, d5nyxn2, d5nyxp2
    automated match to d1dn0a1
    complexed with gol, so4

Details for d5nyxp1

PDB Entry: 5nyx (more details), 1.88 Å

PDB Description: human fab fragment 5h2 against nhba from neisseria meningitidis
PDB Compounds: (P:) light chain

SCOPe Domain Sequences for d5nyxp1:

Sequence, based on SEQRES records: (download)

>d5nyxp1 b.1.1.0 (P:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps
rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtklei

Sequence, based on observed residues (ATOM records): (download)

>d5nyxp1 b.1.1.0 (P:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltrfsgsgsgtdlt
ltisslrpedfatyycqqsygsptfgqgtklei

SCOPe Domain Coordinates for d5nyxp1:

Click to download the PDB-style file with coordinates for d5nyxp1.
(The format of our PDB-style files is described here.)

Timeline for d5nyxp1: