Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d5nyxp1: 5nyx P:1-105 [353111] Other proteins in same PDB: d5nyxl2, d5nyxn2, d5nyxp2 automated match to d1dn0a1 complexed with gol, so4 |
PDB Entry: 5nyx (more details), 1.88 Å
SCOPe Domain Sequences for d5nyxp1:
Sequence, based on SEQRES records: (download)
>d5nyxp1 b.1.1.0 (P:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltyaasslgsgvps rfsgsgsgtdltltisslrpedfatyycqqsygsptfgqgtklei
>d5nyxp1 b.1.1.0 (P:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivmtqtpsslsasvgdrvtitcrasqsisnylnwyqqkpgtapklltrfsgsgsgtdlt ltisslrpedfatyycqqsygsptfgqgtklei
Timeline for d5nyxp1:
View in 3D Domains from other chains: (mouse over for more information) d5nyxl1, d5nyxl2, d5nyxn1, d5nyxn2 |