SCOPe 2.07: Domain d5nyxn2: 5nyx N:106-210

Lineage for d5nyxn2 (5nyx N:106-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d5nyxn2: 5nyx N:106-210 [353004]
   Other proteins in same PDB: d5nyxl1, d5nyxn1, d5nyxp1
   automated match to d1dn0a2
   complexed with gol, so4

Details for d5nyxn2

PDB Entry: 5nyx, 1.88 Å

PDB Description: human fab fragment 5h2 against nhba from neisseria meningitidis

PDB Compounds: (N:) light chain

SCOPe Domain Sequences for d5nyxn2:

Sequence; same for both SEQRES and ATOM records:

>d5nyxn2 b.1.1.2 (N:106-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5nyxn2:

• d5nyxn2 is new in SCOPe 2.07-stable
  
• d5nyxn2 appears in the current release, SCOPe 2.08