Lineage for d6dgib1 (6dgi B:1-115)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470799Species Vibrio cholerae [TaxId:243277] [352809] (1 PDB entry)
  8. 2470801Domain d6dgib1: 6dgi B:1-115 [353070]
    Other proteins in same PDB: d6dgia2, d6dgia3, d6dgib2
    automated match to d5d8da1
    complexed with act, gol, mg

Details for d6dgib1

PDB Entry: 6dgi (more details), 2.3 Å

PDB Description: the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d6dgib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dgib1 c.30.1.0 (B:1-115) automated matches {Vibrio cholerae [TaxId: 243277]}
mtkttilllcgggsseheislvsanyiqqqleltpefhvirvemkkegwfseqgalvyld
tnsatlnsdkasypidfvvpcihgfpgetgdiqsmlelagipylgcgpeasansf

SCOPe Domain Coordinates for d6dgib1:

Click to download the PDB-style file with coordinates for d6dgib1.
(The format of our PDB-style files is described here.)

Timeline for d6dgib1: