Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (39 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [352809] (1 PDB entry) |
Domain d6dgia1: 6dgi A:1-115 [352810] Other proteins in same PDB: d6dgia2, d6dgia3, d6dgib2 automated match to d5d8da1 complexed with act, gol, mg |
PDB Entry: 6dgi (more details), 2.3 Å
SCOPe Domain Sequences for d6dgia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dgia1 c.30.1.0 (A:1-115) automated matches {Vibrio cholerae [TaxId: 243277]} mtkttilllcgggsseheislvsanyiqqqleltpefhvirvemkkegwfseqgalvyld tnsatlnsdkasypidfvvpcihgfpgetgdiqsmlelagipylgcgpeasansf
Timeline for d6dgia1: