Lineage for d5xo1d_ (5xo1 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472415Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472416Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2472469Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2472470Protein automated matches [190499] (25 species)
    not a true protein
  7. 2472638Species Vibrio anguillarum [TaxId:882102] [340428] (4 PDB entries)
  8. 2472646Domain d5xo1d_: 5xo1 D: [353042]
    automated match to d5gleb_

Details for d5xo1d_

PDB Entry: 5xo1 (more details), 2.23 Å

PDB Description: crystal structure of the isochorismatase domain of vabb from vibrio anguillarum 775
PDB Compounds: (D:) Isochorismate lyase

SCOPe Domain Sequences for d5xo1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xo1d_ c.33.1.0 (D:) automated matches {Vibrio anguillarum [TaxId: 882102]}
aipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellanis
elkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkw
rysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsle
dhhhtlkyitervgcvtslealkpqm

SCOPe Domain Coordinates for d5xo1d_:

Click to download the PDB-style file with coordinates for d5xo1d_.
(The format of our PDB-style files is described here.)

Timeline for d5xo1d_: