Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (26 species) not a true protein |
Species Vibrio anguillarum [TaxId:882102] [340428] (4 PDB entries) |
Domain d5xo1d_: 5xo1 D: [353042] automated match to d5gleb_ |
PDB Entry: 5xo1 (more details), 2.23 Å
SCOPe Domain Sequences for d5xo1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xo1d_ c.33.1.0 (D:) automated matches {Vibrio anguillarum [TaxId: 882102]} aipkiasysiplaetfpknkvhwhvqadravllihdmqkyfinffdhsqapvpellanis elkslarqanipvvytaqppnqdpieralltdfwgtgltkdteivselspedgdiqytkw rysafkktpllermketqrdqliivgvyahigilstaldafmldiqpfvvgdavadfsle dhhhtlkyitervgcvtslealkpqm
Timeline for d5xo1d_: