Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [225997] (7 PDB entries) |
Domain d6de8a2: 6de8 A:120-281 [352985] Other proteins in same PDB: d6de8a1, d6de8a3, d6de8b1, d6de8b3 automated match to d3p2oa2 complexed with cl, gol, iod, k |
PDB Entry: 6de8 (more details), 2.1 Å
SCOPe Domain Sequences for d6de8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6de8a2 c.2.1.0 (A:120-281) automated matches {Campylobacter jejuni [TaxId: 192222]} fhpinvgylnlglesgflpctplgvmkllkayeidlegkdaviigasnivgrpmatmlln agatvsvchiktkdlslytrqadliivaagcvnllrsdmvkegvivvdvginrlesgkiv gdvdfeevskkssyitpvpggvgpmtiamllentvksaknrl
Timeline for d6de8a2: